PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P07170_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 201aa    MW: 22987.2 Da    PI: 8.6115
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P07170_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-184396356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           k+++++++q++ Le  F  +r++ a ++++LA+kl+L+ +qV vWFqNrRa++k
  GSMUA_Achr4P07170_001 43 KKRRLSEDQVKLLEMSFMDERKLEAGRKAHLAAKLELDAKQVAVWFQNRRARHK 96
                           45689***********************************************99 PP

2HD-ZIP_I/II106.71.7e-3443134293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls++qvklLE+sF  e+kLe  rK++la +L+l+++qvavWFqnrRAR+k+kq+ + y  Lk a+da++ e+++Le+ev++L+e
  GSMUA_Achr4P07170_001  43 KKRRLSEDQVKLLEMSFMDERKLEAGRKAHLAAKLELDAKQVAVWFQNRRARHKSKQVKEAYVELKLAHDAVVLEKCHLENEVSKLKE 130
                            9*************************************************************************************** PP

            HD-ZIP_I/II  90 elke 93 
                            +l+e
  GSMUA_Achr4P07170_001 131 KLSE 134
                            9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.9533898IPR001356Homeobox domain
SuperFamilySSF466891.88E-1541103IPR009057Homeodomain-like
SMARTSM003891.7E-1541102IPR001356Homeobox domain
CDDcd000861.54E-134399No hitNo description
PfamPF000466.4E-164396IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1645103IPR009057Homeodomain-like
PROSITE patternPS0002707396IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MTEEKKVQIP SLWASERCSQ MPQDSVGEKR TRRRRKKAKG DAKKRRLSED QVKLLEMSFM  60
DERKLEAGRK AHLAAKLELD AKQVAVWFQN RRARHKSKQV KEAYVELKLA HDAVVLEKCH  120
LENEVSKLKE KLSEAEEEVR KLASGMNGAS GGNGESGDGS PSSCFSAASL QWQREEAELM  180
CINEYDFTNY MMMEWADLYG V
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12836KRTRRRRKK
23145RRRRKKAKGDAKKRR
33245RRRKKAKGDAKKRR
43346RRKKAKGDAKKRRL
59098RRARHKSKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395622.11e-146PREDICTED: homeobox-leucine zipper protein HOX12-like
SwissprotQ7XI854e-50HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLM0SLT41e-146M0SLT4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P07170_0011e-146(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.11e-24homeobox protein 40